- MEX3C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81932
- 0.1 ml (also 25ul)
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: NRLADFSPTS PFSTGNFWFG DTLPSVGSED LAVDSPAFDS LPTSAQTIWT PFEPVNPLSG FGSDPSGNMK TQRRGSQPST PRLSP
- MEX3C
- BM-013, MEX-3C, RKHD2, RNF194
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- mex-3 RNA binding family member C
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Zinc Finger
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSP
Specifications/Features
Available conjugates: Unconjugated